PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g13480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family WRKY
Protein Properties Length: 158aa    MW: 17465.5 Da    PI: 8.463
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g13480genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.46e-331067259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+ed ++v++tYeg+H h+
  CA10g13480 10 EDGYRWRKYGQKAVKNSPFPRSYYRCTNTKCTVKKRVERSSEDSSIVITTYEGQHCHH 67
                8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.0E-32268IPR003657WRKY domain
SuperFamilySSF1182902.35E-28367IPR003657WRKY domain
PROSITE profilePS5081129.344469IPR003657WRKY domain
SMARTSM007742.8E-38968IPR003657WRKY domain
PfamPF031067.2E-261067IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MTKSEVDHLE DGYRWRKYGQ KAVKNSPFPR SYYRCTNTKC TVKKRVERSS EDSSIVITTY  60
EGQHCHHTVG FPRGGLINHE AAFTSQLSPL PSQYYHPSGV QYPHELVPMT AAAPVESRTM  120
PGETGSSEAR RLPETSQPAA TDEGLLGDIV PPGMRSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-25166974Probable WRKY transcription factor 4
2lex_A1e-25166974Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0139331e-144BT013933.1 Lycopersicon esculentum clone 132931F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016547995.11e-116PREDICTED: probable WRKY transcription factor 57
SwissprotQ9C9836e-52WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLK4BXX27e-97K4BXX2_SOLLC; Uncharacterized protein
STRINGSolyc05g012500.2.12e-96(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA80312228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.23e-53WRKY DNA-binding protein 57